Synthetic peptide corresponding to a region within N terminal amino acids 143-192 (NDNPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTV L) of Human EY Cadherin (NP_071923).
Cadherins are calcium dependent cell adhesion proteins which mediate cell-to-cell interaction. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. EY cadherin (Cadherin-24) mediates strong cell-cell adhesion.
My Review for Anti-CDH24 (aa 143-192) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.