CDC42EP3 (NP_006440, 42 a.a. ~ 108 a.a) partial recombinant protein with GST tag. The sequence is IHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSP VLKNAIS
Conjugate
Unconjugated
Target
Alternative Names
CDC42EP3; CDC42 effector protein (Rho GTPase binding) 3; UB1; CEP3; BORG2; cdc42 effector protein 3; MSE55-related protein; binder of Rho GTPases 2; CRIB-containing BORG2 protein; MSE55-related Cdc42-binding protein;
This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants.
Citations
Publication ()
Have you cited DPAB-DC257 in a publication? Let us know and earn a reward for your research.
My Review for Anti-CDC42EP3 (aa 42-108) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
