Synthetic peptide within Human C11orf70 aa 196-245 (C terminal). The exact sequence is proprietary.Sequence: LIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYF Database link: Q9BRQ4
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
C11ORF70; chromosome 11 open reading frame 70; uncharacterized protein C11orf70;
My Review for Anti-C11ORF70 (aa 196-245) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
