Specifications
Species Reactivity
Mouse; Rat; Rabbit; Hamster; Human
Immunogen
Recombinant fragment corresponding to Human ATF6 aa 1-273. This monoclonal antibody was made against a partial protein containing amino acids 1-273 of human ATF6.Sequence: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAAN ETYENNFDNL DFDLDLMPWESDIWDINNQIC
Applications
Application Notes
Flow Cyt: 1μg/106 cells; WB: 1 - 5 μg/ml.
Target
Alternative Names
ATF6; activating transcription factor 6; ATF6A; cyclic AMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 alpha;
Product Background
Antigen Description
Transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. Binds DNA on the 5-CCAC[GA]-3half of the ER stress response element (ERSE) (5-CCAAT-N(9)-CCAC[GA]-3) and of ERSE II (5-ATTGG-N-CCACG-3). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor.
Pathway
Activation of Chaperone Genes by ATF6-alpha, organism-specific biosystem; Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Activation of Genes by ATF4, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem.
Citations
Publication ()
Have you cited DCABH-934 in a publication?
Let us know and earn a reward for your research.
COA
Loading ......
