Anti-AIFM1 polyclonal antibody (DPAB-DC3734)

Mouse anti-Human AIFM1 (aa 420-529) polyclonal antibody for ELISA

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
PDCD8 (NP_004199, 420 a.a. ~ 529 a.a) partial recombinant protein with GST tag. The sequence is GFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIR
Conjugate
Unconjugated

Target


Alternative Names
AIFM1; apoptosis-inducing factor, mitochondrion-associated, 1; AIF; CMT2D; CMTX4; COWCK
Entrez Gene ID
UniProt ID

Product Background


Pathway
Apoptosis; Ceramide signaling pathway;

Citations


Have you cited DPAB-DC3734 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Miller, CA; Naish, JH; et al. Voxel-wise quantification of myocardial blood flow with cardiovascular magnetic resonance: effect of variations in methodology and validation with positron emission tomography. JOURNAL OF CARDIOVASCULAR MAGNETIC RESONANCE 16:-(2014).
Nishizaki, T; Kanno, T; et al. 1-[2-(2-Methoxyphenylamino)ethylamino]-3-(naphthalene-1-yloxy)propan-2-ol May Be a Promising Anticancer Drug. MOLECULES 19:21462-21472(2014).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket