Anti-ACTL6A monoclonal antibody, clone O447C/94

Antibody Isotype

IgG1

Clone

O447C/94

Species Reactivity

Mouse; Rat; Human

Immunogen

Fusion protein corresponding to BAF53A. Fusion protein amino acids 43-119 (MVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENME AISPLK NGMVEDWDSFQAILDHTYKMHVKSEASLHP, actin subdomain 2) of human BAF53a.

Conjugate

Application Notes

WB: 1 μg/ml;

Alternative Names

ACTL6A; actin-like 6A; actin-like protein 6A; actin related protein 4; Actl6; Arp4; BAF complex 53 kDa subunit; BAF53A; Baf53a; BRG1 associated factor; INO80 complex subunit K; INO80K; BAF53; arpNbeta; hArpN beta; actin-related protein 4; BRG1-associated

Entrez Gene ID

UniProt ID

Antigen Description

This protein is a family member of actin-related proteins (ARPs), which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This protein is a 53 kDa subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. Together with beta-actin, it is required for maximal ATPase activity of BRG1, and for the association of the BAF complex with chromatin/matrix. It is required for maximal ATPase activity of SMARCA4/BRG1 and for association of the SMARCA4/BRG1 containing remodelling complex BAF with chromatin/nuclear matrix. It is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.

Pathway

C-MYC pathway, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem.