Recombinant protein (VPEGVHALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYI)
Conjugate
Unconjugated
Applications
Application Notes
ICC/IF 0.25-2 ug/ml Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.
Target
Alternative Names
SLC39A9; solute carrier family 39 (zinc transporter), member 9; zinc transporter ZIP9; FLJ11274; zinc transporter SLC39A9; zrt- and Irt-like protein 9; ZIP9; ZIP-9; MGC74989;
My Review for Rabbit Anti-Human SLC39A9 (aa 55-108) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.