This antibody was developed against recombinant ZSCAN25 protein corresponding to amino acids: AKAVPCHRQGEQEETALCRGAWEPGIQLGPVEVKPEWGMPPGEGVQGPDPGTEEQLSQDP GDETRAFQEQA
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:500 - 1:1000
Target
Alternative Names
ZSCAN25; zinc finger and SCAN domain containing 25; ZNF498; zinc finger and SCAN domain-containing protein 25; zinc finger protein 498;
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
