This antibody was developed against recombinant ZNF167 protein corresponding to amino acids: PAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPV PTLPQVGNSGDQAG
Conjugate
Unconjugated
Applications
Application Notes
WB: 1:250 - 1:500 IHC: 1:50 - 1:200
Target
Alternative Names
ZKSCAN7; zinc finger with KRAB and SCAN domains 7; ZFP; ZNF64; ZNF167; ZNF448; ZSCAN39; zinc finger protein with KRAB and SCAN domains 7; zinc finger protein 64; zinc finger protein 167; zinc finger protein 448;
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
