This antibody was developed against recombinant SEC14L5 protein corresponding to amino acids: AMKQYTANVKRGKEVIEHYLNELISQGTSHIPRWTPAPVREEDARNQAGPRDPSSLEAHG PRSTLGPALEAVSMDGDKLDADY
Conjugate
Unconjugated
Applications
Application Notes
WB: 1:100 - 1:250 IHC: 1:200 - 1:500
Target
Alternative Names
SEC14L5; SEC14-like 5 (S. cerevisiae); PRELID4B; SEC14-like protein 5;
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.