Vector coding for a partial recombinant fusion protein, corresponding to amino acids 11-110 of Saccharomyces cerevisiae PRE7.Target sequence used to make the antibody:- YSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY EPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGD GLEILI
Conjugate
Unconjugated
Applications
Application Notes
WB: 1:1000
Target
Alternative Names
PRE7; Pre7p; PRS3; Multicatalytic endopeptidase complex subunit C5; 20S proteasome beta type subunit; Proteasome component C5; PTS1; YBL0407; EC 3.4.25.1Beta 6 subunit of the 20S proteasome; PRS3;
My Review for Anti-PRE7 (aa 11-110) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
