A synthetic peptide corresponding to a region within the N terminal amino acids 36-85 (GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDG RFEVWNAMTRG) of Human LCN12, NP_848631. The immunogen sequence is present in both Q6JVE5 and Q8IW14.
My Review for Anti-LCN12 (aa 36-85) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.