Synthetic peptide corresponding to a region within internal amino acids 288-337 (TVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELK ESSKHVTISNI) of Human FAM71D
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml
Target
Alternative Names
FAM71D; family with sequence similarity 71, member D; C14orf54,chromosome 14 open reading frame 54; protein FAM71D; 4921509E07Rik; 4930516C23Rik; C14orf54; Chromosome 14 open reading frame 54; Family with sequence similarity 71, member D; FLJ36130; GARI-L
My Review for Anti-FAM71D (internal region) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.