This antibody was developed against recombinant DNAH10OS protein corresponding to amino acids: MVPESEWAPWQPQLPCEPKWLGSRKSKPHRESGLRGGGPSRCAKRGTHSCGPRESGGPDT CHL
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:500 - 1:1000
Target
Alternative Names
DNAH10OS; dynein axonemal heavy chain 10 opposite strand; dynein, axonemal, heavy chain 10 opposite strand (non-protein coding)
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.