This antibody was developed against recombinant CTB-133G6.1 protein corresponding to amino acids: LKTWTQGCLSGGGTPAESPGKECDSPKKRGRSRSVPVSFYEIRSPEISPGLEVPTPPVQG LEPPVLECMEKDHVEPDH
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:200 - 1:500
Target
Alternative Names
CTB-133G6.1; Putative uncharacterized protein LOC100996504; Putative uncharacterized protein LOC100996504
My Review for Anti-CTB-133G6.1 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
