Synthetic peptide: MKLCVSAFSLLLLVAAFCDSVLSAPIGSDPPTSCCFSYTS RKIHRNFVMDYYETSSLCSQPAVVFLTKK, corresponding to N terminal amino acids 1 - 69 of Rat Macrophage Inflammatory Protein 1 beta
Conjugate
Unconjugated
Applications
Application Notes
IP: 1:500 ICC/IF: 5μg/ml WB: 1:2000
Target
Alternative Names
CCL4; chemokine (C-C motif) ligand 4; C-C motif chemokine 4; MIP 1 beta; Secreted protein G 26; ACT 2; ACT-2; ACT2; AT744.1; CC chemokine ligand 4; CCL4; CCL4_HUMAN; ccl4l 1; CCL4L1; Chemokine CC Motif Ligand 4; G 26 T lymphocyte secreted protein; G-26 T-
My Review for Anti-CCL4 (aa 1-69) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
