Synthetic peptide within Human ZNF551 aa 31-80 (N terminal). The exact sequence is proprietary.Sequence: FEDVAIYFSQEEWELLDESQRFLYCDVMLENFAHVTSLGYCHGMENEAIA Database link: Q7Z340-3
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
ZNF551; zinc finger protein 551; DKFZp686H1038; KOX 23 protein (56 AA); zinc finger protein KOX23; MGC52307;
My Review for Anti-ZNF551 (aa 31-80) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
