ZNF219 (NP_057507, 143 a.a. ~ 221 a.a) partial recombinant protein with GST tag. The sequence is MQATPATEGLARPQAPSSSAFRCPYCKGKFRTSAERERHLHILHRPWKCGLCSFGSSQEE ELLHHSLTAHGAPERPLAA
ZNF219 (zinc finger protein 219) is a protein-coding gene. Diseases associated with ZNF219 include intrahepatic cholangiocarcinoma, and cholangiocarcinoma. GO annotations related to this gene include histamine receptor activity and sequence-specific DNA binding transcription factor activity. An important paralog of this gene is ZNF217.
Citations
Publication ()
Have you cited DPAB-DC2139 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ZNF219 (aa 143-221) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
