Anti-YOD1 (aa 21-70) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Mouse; Human

Immunogen

Synthetic peptide within Mouse YOD1 aa 21-70 (N terminal). The exact sequence is proprietary.Sequence: VPQSEAGTKAGPAGGRPADTMWRVRCKAKGGTHLLQGLSSRTRLRELQGQ Database link: Q8CB27

Conjugate

Application Notes

WB: 1 μg/ml;

Alternative Names

YOD1; YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae); Hshin7; 9930028C20Rik; ubiquitin thioesterase OTU1; HIV-induced protein-7-like protease;

Entrez Gene ID

UniProt ID

Antigen Description

Hydrolase that can remove conjugated ubiquitin from proteins and participates in endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by triming the ubiquitin chain on the associated substrate to facilitate their threading through the VCP/p97 pore. Ubiquitin moieties on substrates may present a steric impediment to the threading process when the substrate is transferred to the VCP pore and threaded through VCPs axial channel. Mediates deubiquitination of both Lys-48- and Lys-63-linked polyubiquitin chains. Able to cleave both polyubiquitin and di-ubiquitin.

Pathway

Protein processing in endoplasmic reticulum;