Rabbit Anti-Human UPRT Polyclonal Antibody (DPABH-07831)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant Protein, antigen sequence: TGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEIT
Conjugate
Unconjugated

Applications


Application Notes
ICC-IF: 1-4 µg/ml
IHC: 1:50 - 1:200
WB: 4 µg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human stomach shows cytoplasmic positivity in glandular cells.
Immunofluorescent staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.

Target


Alternative Names
UPRT; uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae); UPP; FUR1; uracil phosphoribosyltransferase homolog; UPRTase
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-07831 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Kashuba, E; Kashuba, V; et al. Epstein-Barr virus encoded nuclear protein EBNA-3 binds a novel human uridine kinase/uracil phosphoribosyltransferase. BMC CELL BIOLOGY 3:-(2002).
Kaliberov, SA; Chiz, S; et al. Combination of cytosine deaminase suicide gene expression with DR5 antibody treatment increases cancer cell cytotoxicity. CANCER GENE THERAPY 13:203-214(2006).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket