Anti-UPRT monoclonal antibody (DCABH-6775)

Specifications


Host Species
Mouse
Antibody Isotype
IgG1
Clone
3E21
Species Reactivity
Human
Immunogen
Recombinant full length protein corresponding to Human UPRT aa 1-309. produced in HEK293T cell.Sequence: MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVI LLTGYAHSSLPAELDSGACG GSSLNSEGNSGSGDSSSYDAPAGNSFLE DCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSA DRLIRL
Conjugate
Unconjugated

Applications


Application Notes
ICC/IF: 1/100; IHC-P: 1/150; WB: 1/4000.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
UPRT; uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae); uracil phosphoribosyltransferase homolog; DKFZp781E1243; FUR1; MGC23937
Entrez Gene ID
UniProt ID

Product Background


Pathway
Metabolic pathways, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem;

Citations


Have you cited DCABH-6775 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Takahashi, S; Kato, K; et al. Neural cell adhesion molecule 2 as a target molecule for prostate and breast cancer gene therapy. CANCER SCIENCE 102:808-814(2011).
Kaliberov, SA; Chiz, S; et al. Combination of cytosine deaminase suicide gene expression with DR5 antibody treatment increases cancer cell cytotoxicity. CANCER GENE THERAPY 13:203-214(2006).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket