Recombinant fragment corresponding to Human Uridine Phosphorylase 1 aa 4-47 (N terminal).Sequence: TGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFP Database link: Q16831
Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
Pathway
Drug metabolism - other enzymes; Fluoropyrimidine Activity; Metabolism of nucleotides; Pyrimidine metabolism
Citations
Publication ()
Have you cited DPABH-14969 in a publication? Let us know and earn a reward for your research.
My Review for Anti-UPP1 (aa 4-47) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.