UCK1 (NP_113620, 202 a.a. ~ 276 a.a) partial recombinant protein with GST tag. The sequence is TKKYADVIIPRGVDNMVAINLIVQHIQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGM LTSGKRSHLESSSRP
This gene encodes a uridine-cytidine kinase that catalyzes the phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP) but not the phosphorylation of deoxyribonucleosides or purine ribonucleosides. This enzyme can also phosphorylate uridine and cytidine analogs and uses both ATP and GTP as a phosphate donor. Alternative splicing results in multiple splice variants encoding distinct isoforms.
Pathway
Drug metabolism - other enzymes; Fluoropyrimidine Activity; Metabolism of nucleotides; Pyrimidine metabolism
Citations
Publication ()
Have you cited DPAB-DC3423 in a publication? Let us know and earn a reward for your research.
My Review for Anti-UCK1 (aa 202-276) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
