Anti-TRPM7 (aa 777-855) polyclonal antibody

Species Reactivity

Human

Immunogen

TRPM7 (NP_060142.2, 777 a.a. ~ 855 a.a) partial recombinant protein with GST tag. The sequence is KTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKS KKLPITRKFYAFYHAPIVK

Conjugate

Alternative Names

TRPM7; transient receptor potential cation channel, subfamily M, member 7; CHAK; CHAK1; ALSPDC; LTRPC7; TRP-PLIK; transient receptor potential cation channel subfamily M member 7; LTrpC-7; channel-kinase 1; LTRPC ion channel family member 7; long transien

Entrez Gene ID

UniProt ID

Antigen Description

The protein encoded by this gene is both an ion channel and a serine/threonine protein kinase. The kinase activity is essential for the ion channel function, which serves to increase intracellular calcium levels and to help regulate magnesium ion homeostasis. Defects in this gene are a cause of amyotrophic lateral sclerosis-parkinsonism/dementia complex of Guam.[provided by RefSeq, May 2010]

Pathway

Ion channel transport; Mineral absorption; TRP channels;