Synthetic peptide within Human TRIM16L aa 11-60 (N terminal). The exact sequence is proprietary.Sequence: RKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELETMAAIS Database link: Q309B1
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
TRIM16L; tripartite motif containing 16-like; TRIM70; tripartite motif-containing protein 16-like protein; tripartite motif protein 70; tripartite motif-containing 16-like; tripartite motif-containing protein 70;
This gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-13240 in a publication? Let us know and earn a reward for your research.
Cui, J; Chen, YJ; et al. Mechanisms and pathways of innate immune activation and regulation in health and cancer. HUMAN VACCINES & IMMUNOTHERAPEUTICS 10:3270-3285(2014).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-TRIM16L polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis