Anti-TRIM16L polyclonal antibody (DPABH-13240)


Host Species
Antibody Isotype
Species Reactivity
Synthetic peptide within Human TRIM16L aa 11-60 (N terminal). The exact sequence is proprietary.Sequence: RKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELETMAAIS Database link: Q309B1


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.


Alternative Names
TRIM16L; tripartite motif containing 16-like; TRIM70; tripartite motif-containing protein 16-like protein; tripartite motif protein 70; tripartite motif-containing 16-like
Entrez Gene ID
UniProt ID


Have you cited DPABH-13240 in a publication? Let us know and earn a reward for your research.

Related Products

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket


Cui, J; Chen, YJ; et al. Mechanisms and pathways of innate immune activation and regulation in health and cancer. HUMAN VACCINES & IMMUNOTHERAPEUTICS 10:3270-3285(2014).

Online Inquiry

Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket