Anti-TMX1 monoclonal antibody (DCABH-6787)

Specifications


Host Species
Mouse
Antibody Isotype
IgG1
Clone
2D2
Species Reactivity
Human
Immunogen
Recombinant full length protein corresponding to Human TXNDC aa 1-280. (NP_110382) produced in HEK293T cell.Sequence: MAPSGSLAVPLAVLVLLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIE FYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIITAL PTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSI
Conjugate
Unconjugated

Applications


Application Notes
WB: 1/4000;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
TMX1; thioredoxin-related transmembrane protein 1; thioredoxin domain containing , thioredoxin domain containing 1 , thioredoxin domain containing , TXNDC, TXNDC1; PDIA11; protein disulfide isomerase family A; member 11
Entrez Gene ID
UniProt ID

Citations


Have you cited DCABH-6787 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Yoldas, O; Karaca, T; et al. Tamoxifen citrate: a glimmer of hope for silicosis. JOURNAL OF SURGICAL RESEARCH 193:429-434(2015).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket