Anti-TMX1 polyclonal antibody (DPABH-11246)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide within Human TXNDC aa 230-280. The exact sequence is proprietary. NP_110382.3Sequence: QPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDK S Database link: Q9H3N1
Conjugate
Unconjugated

Applications


Application Notes
WB: 1/2000 - 1/10000.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
TMX1; thioredoxin-related transmembrane protein 1; TMX; TXNDC; PDIA11; TXNDC1
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-11246 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Yoldas, O; Karaca, T; et al. Tamoxifen citrate: a glimmer of hope for silicosis. JOURNAL OF SURGICAL RESEARCH 193:429-434(2015).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket