Synthetic peptide within Human TXNDC aa 230-280. The exact sequence is proprietary. NP_110382.3Sequence: QPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDK S Database link: Q9H3N1
Conjugate
Unconjugated
Applications
Application Notes
WB: 1/2000 - 1/10000.
Target
Alternative Names
TMX1; thioredoxin-related transmembrane protein 1; TMX; TXNDC; PDIA11; TXNDC1; thioredoxin domain containing 1; transmembrane Trx-related protein; thioredoxin domain-containing protein 1; protein disulfide isomerase family A, member 11;
May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions.
Citations
Publication ()
Have you cited DPABH-11246 in a publication? Let us know and earn a reward for your research.
My Review for Anti-TMX1 (aa 230-280) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
