Anti-Tissue Factor Pathway Inhibitor polyclonal antibody (DPAB-DC3054)

Mouse Anti-Human Tissue Factor Pathway Inhibitor polyclonal antibody for WB, ELISA Datasheet

Bring this labeled antibody directly to your bench!

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
TFPI (AAH15514, 152 a.a. ~ 251 a.a) partial recombinant protein with GST tag. The sequence is RFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKSAAHIYQVFLNAFCIHASMFFLGLDSISCLC
Conjugate
Unconjugated

Target


Alternative Names
TFPI; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor); EPI; TFI; LACI; TFPI1
Entrez Gene ID
UniProt ID

Product Background


Pathway
Complement and Coagulation Cascades; Complement and coagulation cascades; Formation of Fibrin Clot (Clotting Cascade); Integrated Breast Cancer Pathway

Citations


Have you cited DPAB-DC3054 in a publication? Let us know and earn a reward for your research.

References


Cowan, PJ; et al. Coagulation and the xenograft endothelium. XENOTRANSPLANTATION 14:7-12(2007).
Soejima, H; Ogawa, H; et al. Heightened tissue factor associated with tissue factor pathway inhibitor and prognosis in patients with unstable angina. CIRCULATION 99:2908-2913(1999).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-Tissue Factor Pathway Inhibitor polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket