Anti-Tissue Factor Pathway Inhibitor polyclonal antibody (DPAB-DC3054)

Mouse Anti-Human Tissue Factor Pathway Inhibitor polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
TFPI (AAH15514, 152 a.a. ~ 251 a.a) partial recombinant protein with GST tag. The sequence is RFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKSAAHIYQVFLNAFCIHASMFFLGLDSISCLC
Conjugate
Unconjugated

Target


Alternative Names
TFPI; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor); EPI; TFI; LACI; TFPI1
Entrez Gene ID
UniProt ID

Product Background


Pathway
Complement and Coagulation Cascades; Complement and coagulation cascades; Formation of Fibrin Clot (Clotting Cascade); Integrated Breast Cancer Pathway

Citations


Have you cited DPAB-DC3054 in a publication? Let us know and earn a reward for your research.

References


Yokoyama, H; Myrup, B; et al. Increased tissue factor pathway inhibitor activity in IDDM patients with nephropathy. DIABETES CARE 19:441-445(1996).
Brenner, B; et al. Haemostatic changes in pregnancy. THROMBOSIS RESEARCH 114:409-414(2004).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-Tissue Factor Pathway Inhibitor polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket