Synthetic peptide within Human TEX13B aa 93-142 (N terminal). The exact sequence is proprietary.Sequence: LQGFAKLHRSAALVLASNLTELKEQQEMECNEATFQLQLTETSLAEVQRE Database link: Q9BXU2
TEX13B (testis expressed 13B) is a protein-coding gene. Diseases associated with TEX13B include azoospermia. An important paralog of this gene is TEX13A.
Citations
Publication ()
Have you cited DPABH-11705 in a publication? Let us know and earn a reward for your research.
My Review for Anti-TEX13B (aa 93-142) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
