SV2A (NP_055664, 474 a.a. ~ 530 a.a) partial recombinant protein with GST tag. The sequence is HLQAVDYASRTKVFPGERVGHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSL
SV2A (synaptic vesicle glycoprotein 2A) is a protein-coding gene. Diseases associated with SV2A include gastrointestinal stromal tumor, and focal epilepsy, and among its related super-pathways are Non-integrin membrane-ECM interactions. GO annotations related to this gene include transmembrane transporter activity and receptor activity. An important paralog of this gene is SV2B.
Pathway
Disease; ECM-receptor interaction; Toxicity of botulinum toxin type A (BoNT/A); Toxicity of botulinum toxin type E (BoNT/E)
Citations
Publication ()
Have you cited DPAB-DC3918 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SV2A (aa 474-530) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
