Synthetic peptide within Human SUMF1 aa 71-120 (N terminal). The exact sequence is proprietary. (NP_877437).Sequence: SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT Database link: Q8NBK3
Using molecular oxygen and an unidentified reducing agent, oxidizes a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also called C(alpha)-formylglycine. Known substrates include GALNS, ARSA, STS and ARSE.
Pathway
Lysosome;
Citations
Publication ()
Have you cited DPABH-12884 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SUMF1 (aa 71-120) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.