Anti-SSR4 monoclonal antibody, clone BU37H6

Antibody Isotype

IgG1

Clone

BU37H6

Species Reactivity

Human

Immunogen

Recombinant fragment corresponding to Human Signal sequence receptor delta aa 24-144. Topological domain (lumenal) purified from E. coli.Sequence: EACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGK QFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNE DISIIP

Conjugate

Alternative Names

SSR4; signal sequence receptor, delta; translocon-associated protein subunit delta; translocon associated protein delta; TRAPD; SSR-delta; TRAP-delta; translocon-associated protein delta; signal sequence receptor subunit delta;

Entrez Gene ID

UniProt ID

Antigen Description

Signal sequence receptor delta is assumed to be involved in protein secretion. It is located in the Xq28 region, arranged in a compact head-to-head manner with the IDH3G gene. These two genes are driven by a bidirectional promoter located between them, and encode proteins involved in unrelated biochemical pathways located in different compartments of the cell. The nontranscribed intergenic region represents only 133 bp and is embedded in a CpG island. The CpG island functions as a bidirectional promoter to initiate the transcription of both functionally unrelated genes with distinct expression patterns. Signal sequence receptor delta consists of six exons and is approximately 70 kb telomeric to the ALD gene. Although alternative splicing of exon 5 has not been detected in human Signal sequence receptor delta, transcript variants missing the region homologous to human exon 5 have been detected in both Xenopus laevis and Mus musculus.

Pathway

Gene Expression, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; SRP-dependent cotranslational protein targeting to membrane, organism-specific biosystem; Translation, organism-specific biosystem; Translocon-associated protein (TRAP) complex, organism-specific biosystem.