SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. The sequence is KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSR KSFSCKYCDKEYV
This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.
Pathway
Adherens junction; Direct p53 effectors; Hippo signaling pathway; Regulation of Wnt-mediated beta catenin signaling and target gene transcription
Citations
Publication ()
Have you cited DPAB-DC2913 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SNAI2 (aa 97-169) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
