Anti-SLC6A4 (aa 181-252) polyclonal antibody

Species Reactivity

Human

Immunogen

SLC6A4 (NP_001036, 181 a.a. ~ 252 a.a) partial recombinant protein with GST tag. The sequence is AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH RSKGLQDLGGIS

Conjugate

Alternative Names

SLC6A4; solute carrier family 6 (neurotransmitter transporter), member 4; HTT; 5HTT; OCD1; SERT; 5-HTT; SERT1; hSERT; 5-HTTLPR; sodium-dependent serotonin transporter; 5HT transporter; serotonin transporter 1; 5-hydroxytryptamine transporter; Na+/Cl- depe

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma.

Pathway

Monoamine Transport; Serotonergic synapse; Synaptic Vesicle Pathway;