Synthetic peptide within Human SLC44A2 aa 259-308 (internal sequence). The exact sequence is proprietary. (NP_065161).Sequence: IMVWVMIIMVILVLGYGIFHCYMEYSRLRGEAGSDVSLVDLGFQTDFRVY Database link: Q8IWA5
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
SLC44A2; solute carrier family 44, member 2; choline transporter-like protein 2; CTL2; PP1292; FLJ44586; DKFZp666A071;
SLC-mediated transmembrane transport; Transmembrane transport of small molecules; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds;
Citations
Publication ()
Have you cited DPABH-12572 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SLC44A2 (aa 259-308) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
