Synthetic peptide within Human SLC35D1 aa 100-148 (internal sequence). The exact sequence is proprietary.Sequence: SDLAFDLEGYAFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFM Database link: B7Z3X2
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
SLC35D1; solute carrier family 35 (UDP-glucuronic acid/UDP-N-acetylgalactosamine dual transporter), member D1; UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter; KIAA0260; UGTREL7; UDP-GlcA/UDP-GalNAc transporter; solute carrier family 35 member D
Transports both UDP-glucuronic acid (UDP-GlcA) and UDP-N-acetylgalactosamine (UDP-GalNAc) from the cytoplasm to into the endoplasmic reticulum lumen. May participate in glucuronidation and/or chondroitin sulfate biosynthesis.
Pathway
Biological oxidations; Formation of the active cofactor, UDP-glucuronate; Glucuronidation; Metabolism; Phase II conjugation; SLC-mediated transmembrane transport; Transmembrane transport of small molecules.
Citations
Publication ()
Have you cited DPABH-12823 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SLC35D1 (aa 100-148) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
