Anti-SLC29A4 (aa 283-345) polyclonal antibody

Species Reactivity

Human

Immunogen

SLC29A4 (NP_694979, 283 a.a. ~ 345 a.a) partial recombinant protein with GST tag. The sequence is VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRAL LLH

Conjugate

Alternative Names

SLC29A4; solute carrier family 29 (equilibrative nucleoside transporter), member 4; ENT4; PMAT; equilibrative nucleoside transporter 4; hENT4; solute carrier family 29 member 4; plasma membrane monoamine transporter; solute carrier family 29 (nucleoside t

Entrez Gene ID

UniProt ID

Antigen Description

This gene is a member of the SLC29 family and encodes a plasma membrane protein with 11 transmembrane helices. This protein catalyzes the reuptake of monoamines into presynaptic neurons, thus determining the intensity and duration of monoamine neural signaling. It has been shown to transport several compounds, including serotonin, dopamine, and the neurotoxin 1-methyl-4-phenylpyridinium. Alternate transcriptional splice variants which encode the same protein have been characterized.

Pathway

SLC-mediated transmembrane transport; Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane;