Anti-SLC25A17 (aa 32-66) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Recombinant fragment corresponding to Human SLC25A17 aa 32-66.Sequence: TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR Database link: O43808

Conjugate

Application Notes

IHC-P: 1/50 - 1/200.

Alternative Names

SLC25A17; solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17; solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kD), member 17; peroxisomal membrane protein PMP34; peroxisomal me

Entrez Gene ID

UniProt ID

Antigen Description

Peroxisomal transporter for multiple cofactors like coenzyme A (CoA), flavin adenine dinucleotide (FAD), flavin mononucleotide (FMN) and nucleotide adenosine monophosphate (AMP), and to a lesser extend for nicotinamide adenine dinucleotide (NAD(+)), adenosine diphosphate (ADP) and adenosine 3,5-diphosphate (PAP). May catalyze the transport of free CoA, FAD and NAD(+) from the cytosol into the peroxisomal matrix by a counter-exchange mechanism. Inhibited by pyridoxal 5-phosphate and bathophenanthroline in vitro.

Pathway

Alpha-oxidation of phytanate; Metabolism; Metabolism of lipids and lipoproteins; Peroxisomal lipid metabolism; Peroxisome;