Synthetic peptide corresponding to a region within the internal sequence amino acids 1296-1345 of Human APXL (TSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM D); NP_001640
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
SHROOM2; shroom family member 2; APXL; HSAPXL; protein Shroom2; apical-like protein; APX homolog of Xenopus;
May be involved in endothelial cell morphology changes during cell spreading. In the retinal pigment epithelium, may regulate the biogenesis of melanosomes and promote their association with the apical cell surface by inducing gamma-tubulin redistribution.
Citations
Publication ()
Have you cited DPABH-18745 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SHROOM2 (aa 1296-1345) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
