Synthetic peptide corresponding to a region within the internal sequence amino acids 1296-1345 of Human APXL (TSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM D); NP_001640
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
SHROOM2; shroom family member 2; APXL; HSAPXL; protein Shroom2; apical-like protein; APX homolog of Xenopus;
May be involved in endothelial cell morphology changes during cell spreading. In the retinal pigment epithelium, may regulate the biogenesis of melanosomes and promote their association with the apical cell surface by inducing gamma-tubulin redistribution.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-18745 in a publication? Let us know and earn a reward for your research.
Hagens, O; Dubos, A; et al. Disruptions of the novel KIAA1202 gene are associated with X-linked mental retardation. HUMAN GENETICS 118:578-590(2006).
Lee, C; Le, MP; et al. The Shroom Family Proteins Play Broad Roles in the Morphogenesis of Thickened Epithelial Sheets. DEVELOPMENTAL DYNAMICS 238:1480-1491(2009).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-SHROOM2 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis
