Anti-SEP15 (aa 97-165) polyclonal antibody

Species Reactivity

Human

Immunogen

SEP15 (NP_004252, 97 a.a. ~ 165 a.a) partial recombinant protein with GST tag. The sequence is KLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEE FLSEKLERI

Conjugate

Alternative Names

SEP15; 15 kDa selenoprotein;

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3 UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. This gene is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Pathway

Selenium Pathway;