Anti-SARS-CoV Nsp2 Polyclonal antibody (DPATB-H83539)

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
SARS-CoV
Immunogen
Fusion protein: SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPR HVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGH SMQNCLLRLKVDTSNPKTPKY, corresponding to amino acids 1-101 of SARS Nsp2. SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPR HVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGH SMQ
Conjugate
Unconjugated

Target


Alternative Names
3C like proteinase,3CL PRO,3CLp,

Product Background


Antigen Description
This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chamb.

Citations


Have you cited DPATB-H83539 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Prentice, E; McAuliffe, J; et al. Identification and characterization of severe acute respiratory syndrome coronavirus replicase proteins. JOURNAL OF VIROLOGY 78:9977-9986(2004).
Hagemeijer, MC; Verheije, MH; et al. Dynamics of Coronavirus Replication-Transcription Complexes. JOURNAL OF VIROLOGY 84:2134-2149(2010).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket