Anti-S100A6 (aa 18-90) polyclonal antibody

Species Reactivity

Human

Immunogen

S100A6 (NP_055439, 18 a.a. ~ 90 a.a) partial recombinant protein with GST tag. The sequence is KYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFL GALALIYSEALKG

Conjugate

Alternative Names

S100A6; S100 calcium binding protein A6; 2A9; PRA; 5B10; CABP; CACY; protein S100-A6; MLN 4; calcyclin; growth factor-inducible protein 2A9; prolactin receptor-associated protein; S100 calcium-binding protein A6 (calcyclin);

Entrez Gene ID

UniProt ID

Antigen Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.

Pathway

Gastric cancer network 2;