Anti-RPRD1B (aa 112-161) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Mouse

Immunogen

Synthetic peptide within Mouse C20orf77 aa 112-161 (internal sequence). The exact sequence is proprietary.Sequence: QERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDY Database link: Q9CSU0-3

Conjugate

Application Notes

WB: 1 μg/ml;

Alternative Names

RPRD1B; regulation of nuclear pre-mRNA domain containing 1B; Crept; 2610304G08Rik; 2810446G03Rik; regulation of nuclear pre-mRNA domain-containing protein 1B; cell cycle-related and expression-elevated protein in tumor;

Entrez Gene ID

UniProt ID

Antigen Description

C20orf77 interacts with the phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. It is a transcriptional regulator which enhances expression of CCND1. It promotes binding of RNA polymerase II to the CCDN1 promoter and to the termination region before the poly-A site but decreases its binding after the poly-A site. It also revents RNA polymerase II from reading through the 3 end termination site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. Also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Promotes cell proliferation.