Synthetic peptide within Mouse RPL36A aa 31-80 (internal sequence). The exact sequence is proprietary.Sequence: DSLYAQRKRRYDRKRSGYGGQTKPIFCKKAKTTKKIVLTLECVEPNCRSK Database link: XP_355309
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
RPL36A; ribosomal protein L36A; 60S ribosomal protein L36a; ribosomal protein L44; 60S ribosomal protein L44; L44L; Rpl44;
RPL36A (ribosomal protein L36a) is a protein-coding gene. Diseases associated with RPL36A include pure red-cell aplasia, and influenza, and among its related super-pathways are Eukaryotic Translation Initiation and Metabolism of RNA. GO annotations related to this gene include structural constituent of ribosome. An important paralog of this gene is RPL36A-HNRNPH2.
Pathway
Cap-dependent Translation Initiation; Cytoplasmic Ribosomal Proteins; Eukaryotic Translation Elongation; Eukaryotic Translation Initiation; Eukaryotic Translation Termination; Formation of a pool of free 40S subunits; GTP hydrolysis and joining of the 60S
Citations
Publication ()
Have you cited DPABH-27661 in a publication? Let us know and earn a reward for your research.
My Review for Anti-RPL36A (aa 31-80) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
