RNF170 (NP_112216, 121 a.a. ~ 193 a.a) partial recombinant protein with GST tag. The sequence is LGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTL LRHAFREMFSVGG
Conjugate
Unconjugated
Target
Alternative Names
RNF170; ring finger protein 170; ADSA; SNAX1; E3 ubiquitin-protein ligase RNF170; putative LAG1-interacting protein;
This gene encodes a RING domain-containing protein that resides in the endoplasmic reticulum (ER) membrane. This protein functions as an E3 ubiquitin ligase and mediates ubiquitination and processing of inositol 1,4,5-trisphosphate (IP3) receptors via the ER-associated protein degradation pathway. It is recruited to the activated IP3 receptors by the ERLIN1/ERLIN2 complex to which it is constitutively bound. Mutations in this gene are associated with autosomal dominant sensory ataxia. Alternatively spliced transcript variants have been found for this gene.
Citations
Publication ()
Have you cited DPAB-DC3357 in a publication? Let us know and earn a reward for your research.
My Review for Anti-RNF170 (aa 121-193) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
