Anti-RGR (aa 76-125) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Synthetic peptide corresponding to a region within N terminal amino acids 76-125 (SLLRVSHRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTR S) of Human RGR, isoform 2 (NP_002912).

Conjugate

Application Notes

WB: 1 μg/ml.

Alternative Names

RGR; retinal G protein coupled receptor; RPE-retinal G protein-coupled receptor; RGR opsin; RGR-opsin; RPE retinal G-protein coupled receptor; RP44;

Entrez Gene ID

UniProt ID

Antigen Description

RGR is a putative retinal G-protein coupled receptor and is a member of the opsin subfamily of the 7 transmembrane, G-protein coupled receptor 1 family. Like other opsins which bind retinaldehyde, it contains a conserved lysine residue in the seventh transmembrane domain. RGR acts as a photoisomerase to catalyze the conversion of all-trans-retinal to 11-cis-retinal (the reverse isomerization occurs with rhodopsin in retinal photoreceptor cells). RGR is exclusively expressed in tissue adjacent to retinal photoreceptor cells, the retinal pigment epithelium and Mueller cells. This gene may be associated with autosomal recessive and autosomal dominant retinitis pigmentosa (arRP and adRP, respectively). Alternative splicing results in multiple transcript variants encoding different isoforms.

Pathway

Class A/1 (Rhodopsin-like receptors); G alpha (i) signalling events; GPCR downstream signaling; GPCR ligand binding; Opsins; Signal Transduction; Signaling by GPCR