Synthetic peptide within Human R3HDM4 aa 45-94 (N terminal). The exact sequence is proprietary. (NP_620129).Sequence: RRKQHFINQAVRNSDLVPKAKGRKSLQRLENTQYLLTLLETDGGLPGLED Database link: Q96D70
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
R3HDM4; R3H domain containing 4; C19orf22; R3H domain-containing protein 4; R3H domain-containing protein C19orf22;
My Review for Anti-R3HDM4 (aa 45-94) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
