Synthetic peptide within Human R3HCC1 aa 164-213 (C terminal). The exact sequence is proprietary. Isoform 2. Genbank: NP_001129580Sequence: VDDTHALGIFPCLASAAEALTREFSVLKIRPLTQGTKQSKLKALQRPKLL Database link: Q9Y3T6-2
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
R3HCC1; R3H domain and coiled-coil containing 1; R3H and coiled-coil domain-containing protein 1;
R3HCC1 (R3H domain and coiled-coil containing 1) is a protein-coding gene. GO annotations related to this gene include nucleotide binding and nucleic acid binding. An important paralog of this gene is R3HCC1L.
Citations
Publication ()
Have you cited DPABH-14037 in a publication? Let us know and earn a reward for your research.
My Review for Anti-R3HCC1 (aa 164-213) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
