Anti-PTH1R polyclonal antibody (DPAB-DC2582)

Mouse anti-Human PTH1R (aa 27-134) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
PTHR1 (NP_000307, 27 a.a. ~ 134 a.a) partial recombinant protein with GST tag. The sequence is DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDY
Conjugate
Unconjugated

Target


Alternative Names
PTH1R; parathyroid hormone 1 receptor; PFE; PTHR; PTHR1; parathyroid hormone/parathyroid hormone-related peptide receptor
Entrez Gene ID
UniProt ID

Product Background


Pathway
Class B/2 (Secretin family receptors); Endocrine and other factor-regulated calcium reabsorption; G alpha (s) signalling events; GPCR ligand binding

Citations


Have you cited DPAB-DC2582 in a publication? Let us know and earn a reward for your research.

References


Azevedo-Neto, RD; Gonzaga, CC; et al. Fragmented Adipose Tissue Transplanted to Craniofacial Deformities Induces Bone Repair Associated With Immunoexpression of Adiponectin and Parathyroid Hormone 1-Receptor. CLEFT PALATE-CRANIOFACIAL JOURNAL 50:639-647(2013).
Monego, G; Lauriola, L; et al. Parathyroid Hormone-Related Peptide and Parathyroid Hormone-Related Peptide Receptor Type 1 Expression in Human Lung Adenocarcinoma. CHEST 137:898-908(2010).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-PTH1R polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket