Anti-PTH1R polyclonal antibody (DPAB-DC2582)

Mouse anti-Human PTH1R (aa 27-134) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
PTHR1 (NP_000307, 27 a.a. ~ 134 a.a) partial recombinant protein with GST tag. The sequence is DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDY
Conjugate
Unconjugated

Target


Alternative Names
PTH1R; parathyroid hormone 1 receptor; PFE; PTHR; PTHR1; parathyroid hormone/parathyroid hormone-related peptide receptor
Entrez Gene ID
UniProt ID

Product Background


Pathway
Class B/2 (Secretin family receptors); Endocrine and other factor-regulated calcium reabsorption; G alpha (s) signalling events; GPCR ligand binding

Citations


Have you cited DPAB-DC2582 in a publication? Let us know and earn a reward for your research.

References


Guo, J; Song, LG; et al. Fluorescent ligand-directed co-localization of the parathyroid hormone 1 receptor with the brush-border scaffold complex of the proximal tubule reveals hormone-dependent changes in ezrin immunoreactivity consistent with inactivation. BIOCHIMICA ET BIOPHYSICA ACTA-MOLECULAR CELL RESEARCH 1823:2243-2253(2012).
Romero, M; Ortega, A; et al. Parathyroid hormone-related protein induces hypertrophy in podocytes via TGF-beta 1 and p27-(KIP1): implications for diabetic nephropathy. NEPHROLOGY DIALYSIS TRANSPLANTATION 25:2447-2457(2010).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-PTH1R polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket