Anti-PRMT6 (aa 241-316) polyclonal antibody

Species Reactivity

Human

Immunogen

HRMT1L6 (NP_060607, 241 a.a. ~ 316 a.a) partial recombinant protein with GST tag. The sequence is ESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRY KVGDQEEKTKDFAMED

Conjugate

Alternative Names

PRMT6; protein arginine methyltransferase 6; HRMT1L6; protein arginine N-methyltransferase 6; HMT1 hnRNP methyltransferase-like 6; histone-arginine N-methyltransferase PRMT6; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6;

Entrez Gene ID

UniProt ID

Antigen Description

The protein encoded by this gene belongs to the arginine N-methyltransferase family, which catalyze the sequential transfer of methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins, to form methylated arginine derivatives and S-adenosyl-L-homocysteine. This protein can catalyze both, the formation of omega-N monomethylarginine and asymmetrical dimethylarginine, with a strong preference for the latter. It specifically mediates the asymmetric dimethylation of Arg2 of histone H3, and the methylated form represents a specific tag for epigenetic transcriptional repression. This protein also forms a complex with, and methylates DNA polymerase beta, resulting in stimulation of polymerase activity by enhancing DNA binding and processivity.